PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca11233.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NAC
Protein Properties Length: 247aa    MW: 28794.2 Da    PI: 5.1978
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca11233.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM158.52.8e-4961361128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.. 95 
                 lppGfrF+Ptdeelv +yLk+kve  ++el evi+ ++ yk++PwdLp +  + +++ ew+fFs+rd+ky++g+r+nratk+g+Wkatgkd++v+++  
  Dca11233.1   6 LPPGFRFRPTDEELVGFYLKRKVEMLETEL-EVIPVIEFYKYDPWDLPdRsFLPKRDMEWFFFSPRDRKYPNGSRTNRATKAGFWKATGKDRKVVCEsg 103
                 79*************************999.99**************95335566888**************************************976 PP

         NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                 +++++g +ktLvfy+grap g++tdW+m eyrl
  Dca11233.1 104 SESVTGFRKTLVFYQGRAPLGHRTDWMMYEYRL 136
                 66779**************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.63E-553152IPR003441NAC domain
PROSITE profilePS5100556.0566152IPR003441NAC domain
PfamPF023651.1E-267136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MRSATLPPGF RFRPTDEELV GFYLKRKVEM LETELEVIPV IEFYKYDPWD LPDRSFLPKR  60
DMEWFFFSPR DRKYPNGSRT NRATKAGFWK ATGKDRKVVC ESGSESVTGF RKTLVFYQGR  120
APLGHRTDWM MYEYRLSDDT HGAFVLCRVI KKNGFNEKAK AQDEMSSAYY SFSEFDHSTL  180
LQFQPYQQPG GSPSTSYSNF AENETVDGLN LFGCMSPYYA DIDYMTYMGD YGNVSDFYDS  240
YENPTSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-46115812171NAC domain-containing protein 19
4dul_A2e-46115812171NAC domain-containing protein 19
1ut7_B2e-46115812171NO APICAL MERISTEM PROTEIN
1ut7_A2e-46115812171NO APICAL MERISTEM PROTEIN
1ut4_B2e-46115812171NO APICAL MERISTEM PROTEIN
1ut4_A2e-46115812171NO APICAL MERISTEM PROTEIN
3swp_D3e-46115815174NAC domain-containing protein 19
3swp_C3e-46115815174NAC domain-containing protein 19
3swp_B3e-46115815174NAC domain-containing protein 19
3swp_A3e-46115815174NAC domain-containing protein 19
3swm_D3e-46115815174NAC domain-containing protein 19
3swm_C3e-46115815174NAC domain-containing protein 19
3swm_B3e-46115815174NAC domain-containing protein 19
3swm_A3e-46115815174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014510010.13e-89PREDICTED: NAC domain-containing protein 45-like
SwissprotQ9FFI53e-64NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A088FL452e-92A0A088FL45_9CARY; Putative NAC transcription factor